Nitz Eatz
RecipesPantryImport Recipe
Meal Plan

Browse by diet

  • Vegan
  • Vegetarian
  • Pescatarian
  • Gluten-free
  • Dairy-free
  • Keto
  • Low-carb
  • Paleo
  • Mediterranean
  • Plant-based
  • Heart-healthy
  • Diabetic-friendly
  • Kid-friendly
  • Budget-friendly
  • 30-min
  • Slow cooker
  • Halal
  • Kosher
  • Jain vegetarian

© 2026 Nitz Eatz

Nitz Eatz
RecipesPantryImport Recipe
Meal Plan
BBQ Pork Sloppy Joes
dinner

BBQ Pork Sloppy Joes

Saucy BBQ pulled pork piled on toasted buns with quick-pickled onion and roasted sweet potato

45 min total
4 servings
$2.63–$4.39/serving
Tap to rate
americanweeknightfamily-friendlycomfort-food

Ingredients

  • 2 potatoes
  • 1 red onions
  • 2 cloves garlic
  • 1 lime
  • 2 bread
  • 1 lb pork
  • 1 barbeque sauce
  • 1 hotsauce
  • 1 tomato ketchup
  • 1 sugar
  • 1 vegetable oil
  • 1 salt
  • 1 pepper

Instructions

  1. 1.1
  2. 2.Preheat oven to 450 degrees. Wash and dry all produce. Cut sweet potatoes into ½-inch-thick wedges. Toss on a baking sheet with a drizzle of oil, salt, and pepper. Roast until browned and tender, 20-25 minutes.
  3. 3.2
  4. 4.Meanwhile, halve and peel onion. Slice as thinly as possible until you have ¼ cup (½ cup for 4 servings); finely chop remaining onion. Peel and finely chop garlic. Halve lime; squeeze juice into a small bowl. Halve buns. Add 1 TBSP butter (2 TBSP for 4) to a separate small microwave-safe bowl; microwave until melted, 30 seconds. Brush onto cut sides of buns.
  5. 5.3
  6. 6.To bowl with lime juice, add sliced onion, ¼ tsp sugar (½ tsp for 4 servings), and a pinch of salt. Stir to combine; set aside to quick-pickle.
  7. 7.4
  8. 8.Heat a drizzle of oil in a large pan over medium-high heat. Add chopped onion and season with salt and pepper. Cook, stirring, until softened, 4-5 minutes. Add garlic and cook until fragrant, 30 seconds more. Add pork and season with salt and pepper. Cook, breaking up meat into pieces, until browned and cooked through, 4-6 minutes.
  9. 9.5
  10. 10.While pork cooks, in a third small bowl, combine BBQ sauce, pickling liquid from onion, 3 TBSP ketchup (6 TBSP for 4 servings), ½ tsp sugar (1 tsp for 4), and ¼ cup water (⅓ cup for 4). Once pork is cooked through, add BBQ sauce mixture to pan. Cook, stirring, until sauce is thickened, 2-3 minutes. Taste and season with salt and pepper.
  11. 11.6
  12. 12.Meanwhile, toast buns in oven or toaster oven until golden, 3-5 minutes. Divide toasted buns between plates and fill with as much BBQ pork as you’d like. Top with pickled onion and hot sauce. Serve with sweet potato wedges on the side.

Nutrition Facts

Estimated · USDA
Based on 1 serving

Calories

395 kcal

Carbs

26.5 g

Protein

34.4 g

Fat

16.5 g

Fiber

3.1 g

Sugar

2.8 g

Estimated per serving from ingredients using USDA FoodData Central data. Actual values vary with brands, sizes, and preparation.